PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_46335_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 99aa    MW: 11318.8 Da    PI: 11.0389
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_46335_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.61.9e-151554344
                                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
                      Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                                         ++++eE+   +d+ +q+G++ W++Ia +++ gRt++++k++w
  cra_locus_46335_iso_1_len_297_ver_3 15 KFSAEEERTVIDLQAQFGNK-WAKIATYLP-GRTDNDVKNFW 54
                                         89******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.45E-16165IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-19260IPR009057Homeodomain-like
PROSITE profilePS5129419.407762IPR017930Myb domain
SMARTSM007178.2E-131260IPR001005SANT/Myb domain
CDDcd001671.37E-101554No hitNo description
PfamPF002491.4E-131554IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 99 aa     Download sequence    Send to blast
RWVNKLRPNL KNGVKFSAEE ERTVIDLQAQ FGNKWAKIAT YLPGRTDNDV KNFWSSRQKR  60
LARILQTPSS SSSSNKSQKS SKHVLAIHDV PYLETSKFG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008356546.11e-47PREDICTED: myb-related protein Zm38-like
SwissprotA2WW875e-24GAM1_ORYSI; Transcription factor GAMYB
SwissprotQ0JIC25e-24GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLA0A068UMH97e-51A0A068UMH9_COFCA; Uncharacterized protein
STRINGPOPTR_0002s14180.12e-45(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42072342